PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0042s0037.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 416aa    MW: 47892 Da    PI: 10.2955
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0042s0037.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B352.78e-1717106198
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          ffkv      ++++r+ +p +f++ + g + +     l  +sg++W+v+l   + +++ ++t+GW+ Fvk+n +++gDf+ Fkl+ +  f
  Kaladp0042s0037.1.p  17 FFKVY--IADHSLNRMKVPSEFVDYMRGRTWG--AAELAGPSGETWQVEL--AREGKHLFFTDGWQTFVKENMVEQGDFLFFKLHCNLMF 100
                          67777..455667889*******666777766..69999***********..*******************************9875444 PP

                          ..EEEEE- CS
                   B3  91 elvvkvfr 98 
                             v +f+
  Kaladp0042s0037.1.p 101 --SVVIFD 106
                          ..666665 PP

2B352.68.4e-171882671497
                          T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                   B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                            l++p +f++eh+++ e++ +++l ++++ sWev++   +++g++ l +GW  F+++ +L++gD++ F+l++r   e+ v+v 
  Kaladp0042s0037.1.p 188 YYLRFPQPFIREHSLNYESNEKMVLLTSNNSSWEVNI--INNGGAISLCRGWAAFARDINLRVGDVCKFELMDR--LEMAVHVS 267
                          56899********99999999****************..99999**************************9874..55566665 PP

3B3551.5e-17319413199
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          f+  +++ +v +  +l +p  f++e++    + ++++l+++   sW+v+l    ++ +y l +GW  Fv++n++kegD++ F+l++  + 
  Kaladp0042s0037.1.p 319 FVACMKKYHVKRPFILHIPTWFVRENSVRYGRLQKMVLRTTGDSSWSVNL--HHSQHKYRLYGGWAVFVRDNNIKEGDTCKFELVN--RL 404
                          556677778888899***********666678889***************..888888*************************976..67 PP

                          ..EEEEE-S CS
                   B3  91 elvvkvfrk 99 
                          e++v++ r+
  Kaladp0042s0037.1.p 405 EMKVHIMRR 413
                          789999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.0E-2011110IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-2011110IPR015300DNA-binding pseudobarrel domain
CDDcd100175.05E-1515106No hitNo description
PROSITE profilePS5086313.22515108IPR003340B3 DNA binding domain
PfamPF023621.3E-1417106IPR003340B3 DNA binding domain
SMARTSM010191.2E-1217108IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-18168268IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.44E-19172267IPR015300DNA-binding pseudobarrel domain
CDDcd100171.33E-13173266No hitNo description
PROSITE profilePS5086312.76175270IPR003340B3 DNA binding domain
SMARTSM010192.4E-8175272IPR003340B3 DNA binding domain
PfamPF023625.7E-14188266IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.2E-23313414IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.57E-22316414IPR015300DNA-binding pseudobarrel domain
CDDcd100171.43E-17317410No hitNo description
PROSITE profilePS5086313.267319414IPR003340B3 DNA binding domain
PfamPF023624.8E-15319413IPR003340B3 DNA binding domain
SMARTSM010193.3E-12319414IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MRIDVEEEAD TDNLPEFFKV YIADHSLNRM KVPSEFVDYM RGRTWGAAEL AGPSGETWQV  60
ELAREGKHLF FTDGWQTFVK ENMVEQGDFL FFKLHCNLMF SVVIFDETMC EKGVDLGAKS  120
SRGRDGVLQA EKAQNGAKPV RKNKVRRSLS KGDLITSDPK DRAAERTSTS VKPSFLQHIK  180
ISNLQQGYYL RFPQPFIREH SLNYESNEKM VLLTSNNSSW EVNIINNGGA ISLCRGWAAF  240
ARDINLRVGD VCKFELMDRL EMAVHVSQRH VEIRPEKVNA ARLKLRPLTR AVGVSQRLLR  300
HEGKKEAARS RPSSVKPSFV ACMKKYHVKR PFILHIPTWF VRENSVRYGR LQKMVLRTTG  360
DSSWSVNLHH SQHKYRLYGG WAVFVRDNNI KEGDTCKFEL VNRLEMKVHI MRRSK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.11e-20B3 family protein